Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein
Produktgrößen
10 ug
£145,00
RP00291-10UG
20 ug
£193,00
RP00291-20UG
50 ug
£288,00
RP00291-50UG
100 ug
£431,00
RP00291-100UG
500 ug
£1240,00
RP00291-500UG
1000 ug
£1954,00
RP00291-1000UG
Über dieses Produkt
- SKU:
- RP00291
- Zusätzliche Namen:
- FCGR3B,CD16,CD16b,FCG3,FCGR3,FCR-10,FCRIII,FCRIIIb
- Weitere Details:
- CD16 is a low affinity Fc receptor, and has been identified as Fc receptors FcG GammaRIIIa (CD16a) and FcG GammaRIIIb (CD16b). These receptors function in the activation or inhibition of immune responses. CD16 encoded by two different highly homologous genes in a cell type-specific manner.CD16 is found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16B is also kown as FCGR3B and FCG3B, is expressed specifically by polymorphonuclear leukocytes (neutrophils) and stimulated eosinophils. CD16B is the low affinity receptor for the Fc region of immunoglobulins gamma. CD16B may serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
- Formulierung:
- Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr20-Gln208) of human Fc gamma RIIIB/CD16b (Acc
- Immunogen:
- Thr20-Gln208
- Molekulargewicht:
- 40-55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00291
