Recombinant Human TNFRSF9/4-1BB/CD137 Protein
Produktgrößen
50 ug
£240,00
RP00276-50UG
100 ug
£336,00
RP00276-100UG
500 ug
£1002,00
RP00276-500UG
1000 ug
£1574,00
RP00276-1000UG
Über dieses Produkt
- SKU:
- RP00276
- Zusätzliche Namen:
- TNFRSF9,4-1BB,CD137,CDw137,ILA
- Weitere Details:
- Recombinant Human TNFRSF9/4-1BB/CD137 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu 24 - Gln 186) of human 4-1BB/CD137 (Accession #NP_001552) fused with an Fc, 6xHis tag at the C-terminus.
- Formulierung:
- Recombinant Human TNFRSF9/4-1BB/CD137 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu 24 - Gln 186) of human 4-1BB/CD137 (Accession #NP_001552) fuse
- Immunogen:
- Leu24-Gln186
- Molekulargewicht:
- 55-70 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00276
