Recombinant Human LMIR2/CD300c Protein
Produktgrößen
10 ug
£127,00
RP00264-10UG
20 ug
£175,00
RP00264-20UG
50 ug
£240,00
RP00264-50UG
100 ug
£336,00
RP00264-100UG
500 ug
£1002,00
RP00264-500UG
1000 ug
£1574,00
RP00264-1000UG
Über dieses Produkt
- SKU:
- RP00264
- Zusätzliche Namen:
- CD300C,CLM-6,CMRF-35,CMRF-35A,CMRF35,CMRF35-A1,CMRF35A,CMRF35A1,IGSF16,LIR
- Weitere Details:
- The recombinant human CD300C consists of 166 amino acids with a molecular weight of 18.4 kDa. The apparent molecular mass of recombinant human CD300C is about 40-45 kDa in SDS-PAGE under reducing conditions due to glycosylation.The cluster of differentiation (CD) system is commonly used as cell markers in immunophynotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules which associating with the immune function of the cell. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. CD300C is present on the surface of natural killer cells, granulocytes, most myeloid cells, dendritic cells, and a subpopulation of T and B lymphocytes. Mouse CD300C has the characteristics of an activatory molecule capable of inducing cellular activation and effector function in most cells and macrophages. The ligand for CD300C is presently unknown.
- Formulierung:
- Recombinant Human LMIR2/CD300c Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly 21 - Arg 183 ) of human CD300C (Accession #NP_006669.1) fused w
- Immunogen:
- Gly21-Arg183
- Molekulargewicht:
- 40-55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00264