Recombinant Human Growth hormone receptor/GHR Protein
Produktgrößen
100 ug
£353,00
RP00251-100UG
500 ug
£1002,00
RP00251-500UG
1000 ug
£1574,00
RP00251-1000UG
Über dieses Produkt
- SKU:
- RP00251
- Zusätzliche Namen:
- GHR,GHBP,GHIP
- Weitere Details:
- Recombinant Human Growth hormone receptor/GHR Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala 27 - Tyr 264 ) of human Growth Hormone Receptor (GHR) (Accession #NP_000154.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulierung:
- Recombinant Human Growth hormone receptor/GHR Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala 27 - Tyr 264 ) of human Growth Hormone Receptor (GHR)
- Immunogen:
- Ala27-Tyr264
- Molekulargewicht:
- 70-85 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00251
