Recombinant Human NKG2D ligand 3/ULBP3 Protein
Produktgrößen
10 ug
£193,00
RP00240-10UG
20 ug
£258,00
RP00240-20UG
50 ug
£383,00
RP00240-50UG
100 ug
£586,00
RP00240-100UG
500 ug
£1716,00
RP00240-500UG
1000 ug
£2716,00
RP00240-1000UG
Über dieses Produkt
- SKU:
- RP00240
- Zusätzliche Namen:
- ULBP3
- Weitere Details:
- ULBP-3 is a member of a family of cell-surface proteins that function as ligands for human NKG2D. ULBP-3 has also been described under the names RaeT1N (retinoic acid early transcript), NKG2DL3, and ALCAN-gamma. The name ULBP-3 derives from the original identification of three proteins, ULBP-1, -2, and -3, as ligands for the human cytomegalovirus glycoprotein UL16; they were designated UL16 binding proteins (ULBP). The gene for ULBP-3 resides in a cluster of ten related genes, six of which encode potentially functional glycoproteins. Amino acid sequence identity within this family ranges from 30-60%. These proteins are distantly related to MHC class I proteins, but they possess only the alpha 1 and alpha 2 Ig-like domains, and they have no capacity to bind peptide or interact with beta 2-microglobulin. Some family members, including ULBP-3, are anchored to the membrane via a GPI-linkage, whereas others have transmembrane domains.
- Formulierung:
- Recombinant Human NKG2D ligand 3/ULBP3 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gly27-Pro216) of human ULBP-3 (Accession #NP_078794) fused with a
- Immunogen:
- Gly27-Pro216
- Molekulargewicht:
- 55-60 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00240