Recombinant Human Kallikrein-8/KLK8 Protein
Produktgrößen
10 ug
£193,00
RP00226-10UG
50 ug
£383,00
RP00226-50UG
100 ug
£586,00
RP00226-100UG
500 ug
£1716,00
RP00226-500UG
1000 ug
£2716,00
RP00226-1000UG
Über dieses Produkt
- SKU:
- RP00226
- Zusätzliche Namen:
- KLK8, HNP, NP, NRPN, PRSS19, TADG14, kallikrein-8,Kallikrein 8,HNP,NP,NRPN,PRSS19,TADG14
- Weitere Details:
- Kallikrein-8, also known as Neuropsin, Serine protease 19, Serine protease TADG-14, Tumor-associated differentially expressed gene 14 protein and KLK8, is a secreted protein which belongs to the peptidase S1 family and Kallikrein subfamily. It is a serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Kallikrein-8 / KLK8 is involved in skin desquamation and keratinocyte proliferation and plays a role in the secondary phase of pathogenesis following spinal cord injury. Kallikrein-8 / KLK8 is expressed at high levels in serum, ascites fluid and tumor cytosol of advanced stage ovarian cancer patients and may serve as a marker of ovarian cancer.
- Formulierung:
- Recombinant Human Kallikrein-8/KLK8 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln29-Gly260) of human KLK-8/Kallikrein-8 (Accession #NP_00912
- Immunogen:
- Gln29-Gly260
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP00226