Recombinant Human IFN-lambda 3/IL-28B Protein
Produktgrößen
10 ug
£145,00
RP00219-10UG
20 ug
£193,00
RP00219-20UG
500 ug
£1240,00
RP00219-500UG
1000 ug
£1954,00
RP00219-1000UG
Über dieses Produkt
- SKU:
- RP00219
- Zusätzliche Namen:
- IFNL3,IFN-lambda-3,IFN-lambda-4,IL-28B,IL-28C,IL28B,IL28C
- Weitere Details:
- Interleukin-28B (IL-28B) also known as Interferon lambda-3 and IFN-lambda-3, belongs to the type III interferon family of cytokines. IL-28B is a cytokine with immunomodulatory activity. It functions in Up-regulating MHC class I antigen expression. IL-28B displays potent antiviral activity and antitumor activity. This cytokine serves as ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. IL-28B is able to increase the percentage of splenic CD8+ T cells in vaccinated animals and have higher antigen-specific cytolytic .
- Formulierung:
- Recombinant Human IFN-lambda 3/IL-28B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Val196) of human IFNL3/IL28B/Interleukin-28B (Accession
- Immunogen:
- Met1-Val196
- Molekulargewicht:
- 23 kda
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00219
