Recombinant Human B7-H4/VTCN1 Protein
Produktgrößen
10 ug
£133,00
RP00218-10UG
20 ug
£181,00
RP00218-20UG
50 ug
£240,00
RP00218-50UG
100 ug
£353,00
RP00218-100UG
500 ug
£1002,00
RP00218-500UG
1000 ug
£1574,00
RP00218-1000UG
Über dieses Produkt
- SKU:
- RP00218
- Zusätzliche Namen:
- VTCN1,B7-H4,B7H4,B7S1,B7X,B7h.5,PRO1291,VCTN1
- Weitere Details:
- B7 homolog 4 (B7-H4, VTCN1) is a member of the B7 family of cell surface ligands that regulate T cell activation and immune responses.B7-H4 is expressed on the surface of activated lymphocytes, macrophages, monocytes, dendritic cells, epithelial cells, and bone marrow-derived mesenchymal stem cells. Its binding to activated T cells dampens T cell responses and induces cell cycle arrest in the T cell.The B7-H4 protein is also found in ovarian cancer , breast cancer, renal cell carcinoma, and rheumatoid arthritis patients.Research studies indicate that B7-H4 protein is present on the surface of ovarian tumor cells, and that targeted inhibition of B7-H4 using recombinant antibodies restores T cell activation pathways. These studies suggest some potential therapeutic value in blocking B7-H4 function and restoring T cell function in cancer patients.
- Formulierung:
- Recombinant Human B7-H4/VTCN1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe29-Ala258) of human B7-H4/B7S1/B7x (Accession #NP_078902.2) fused
- Immunogen:
- Phe29-Ala258
- Molekulargewicht:
- 45-60 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00218
