Recombinant Human IL-17A/CTLA-8 Protein
Produktgrößen
10 ug
£133,00
RP00212-10UG
20 ug
£181,00
RP00212-20UG
50 ug
£240,00
RP00212-50UG
100 ug
£353,00
RP00212-100UG
500 ug
£1002,00
RP00212-500UG
1000 ug
£1574,00
RP00212-1000UG
Über dieses Produkt
- SKU:
- RP00212
- Zusätzliche Namen:
- IL17A, CTLA-8, CTLA8, IL-17, IL-17A, IL17, interleukin-17A,CTLA-8,CTLA8,IL-17,IL-17A,IL17
- Weitere Details:
- IL17, also known as IL17a and CTLA8, is a is a 15-20 kDa glycosylated cytokine which belongs to the IL-17 family. The IL-17 family of cytokines includes six members, IL-17/IL-17A, IL-17B, IL-17C, IL-17D, IL-17E/IL-25, and IL-17F, which are produced by multiple cell types. IL17A promotes protective mucosal and epidermal inflammation in response to microbial infection .It induces chemokine production, neutrophil influx, and the production of antibacterial peptides .IL17A additionally enhances the production of inflammatory mediators by rheumatoid synovial fibroblasts and contributes to TNF alpha induced shock . In contrast, it can protect against the progression of colitis by limiting chronic inflammation . IL17A encourages the formation of autoreactive germinal centers and exacerbates the onset and progression of experimental models of autoimmunity .
- Formulierung:
- Recombinant Human IL-17A/CTLA-8 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile20-Ala155) of human IL-17A (Accession #NP_002181.1) fused with
- Immunogen:
- Ile20-Ala155
- Molekulargewicht:
- 18-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- IVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00212
