Recombinant Human CD301 Protein
Produktgrößen
10 ug
£127,00
RP00207-10UG
20 ug
£175,00
RP00207-20UG
50 ug
£240,00
RP00207-50UG
500 ug
£1002,00
RP00207-500UG
1000 ug
£1574,00
RP00207-1000UG
Über dieses Produkt
- SKU:
- RP00207
- Zusätzliche Namen:
- CLEC10A,CD301,CLECSF13,CLECSF14,HML,HML2,MGL
- Weitere Details:
- CLEC10A, also known as macrophage galactose/N-acetyl-galactosamine (GalNAc) specific lectin (MGL), CD301, DC-ASGPR, and HML, is a 40 kDa type II transmembrane glycoprotein that belongs to the C-type lectin family. C-type lectin family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. CLEC10A is expressed on macrophages and related cells of myeloid origins, particularly immature dendritic cells (DCs). CLEC10A plays a protective role against colitis by effectively inducing IL-10 production by colonic lamina propria macrophages in response to invading commensal bacteria.
- Formulierung:
- Recombinant Human CD301 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln61-His316) of human CLEC10A/MGL1/CD301 (Accession #NP_878910.1) fused w
- Immunogen:
- Gln61-His316
- Molekulargewicht:
- Approximately 40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00207