Recombinant Human IL-6 Protein
Produktgrößen
20 ug
£157,00
RP00201-20UG
10 ug
£163,00
RP00201-10UG
50 ug
£223,00
RP00201-50UG
100 ug
£336,00
RP00201-100UG
500 ug
£937,00
RP00201-500UG
1000 ug
£1478,00
RP00201-1000UG
Über dieses Produkt
- SKU:
- RP00201
- Zusätzliche Namen:
- IL6,BSF-2,BSF2,CDF,HGF,HSF,IFN-beta-2,IFNB2,IL-6
- Weitere Details:
- Interleukin-6 (IL-6) is a multifunctional A Alpha-helical cytokine that regulates cell growth and differentiation of various tissues, which is known particularly for its role in the immune response and acute phase reactions. The encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this protein is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis.
- Formulierung:
- Recombinant Human IL-6 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Val30-Met212) of human IL6 (Accession #NP_000591.1) fused with a 6xHis tag at the
- Immunogen:
- Val30-Met212
- Molekulargewicht:
- 23-30
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00201
