Recombinant Human WIF-1(Q166K) Protein
Produktgrößen
10 ug
£127,00
RP00190-10UG
20 ug
£175,00
RP00190-20UG
50 ug
£240,00
RP00190-50UG
100 ug
£336,00
RP00190-100UG
500 ug
£1002,00
RP00190-500UG
1000 ug
£1574,00
RP00190-1000UG
Über dieses Produkt
- SKU:
- RP00190
- Zusätzliche Namen:
- WIF-1,WIF1
- Weitere Details:
- WIF (Wnt Inhibitory Factor) is a secreted protein that binds to Wnt proteins and inhibits their activity. WIF is extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-like domains, and is thought to be involved in mesoderm segmentation.. WIF-1 is implicated as an early event tumor suppressor in cancers of the prostate, breast, lung and bladder. However, WIF-1's role in carcinogenesis may not be that simple since in other cancer types, such as colon adenocarcinoma, WIF facilitates tumorigenesis.
- Formulierung:
- Recombinant Human WIF-1(Q166K) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly29-Trp379(Gln166Lys)) of human WIF-1 (Accession #NP_009122.2) fu
- Immunogen:
- Gly29-Trp379(Q166K)
- Molekulargewicht:
- 45-55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00190