Recombinant Human NKp30/NCR3/CD337 Protein
Produktgrößen
10 ug
£133,00
RP00179-10UG
20 ug
£181,00
RP00179-20UG
50 ug
£240,00
RP00179-50UG
100 ug
£353,00
RP00179-100UG
500 ug
£1002,00
RP00179-500UG
1000 ug
£1574,00
RP00179-1000UG
Über dieses Produkt
- SKU:
- RP00179
- Zusätzliche Namen:
- NCR3,1C7,CD337,LY117,MALS,NKp30
- Weitere Details:
- Natural Cytotoxicity Triggering Receptor 3, NCR3, also known as NKp30, or CD337, is a natural cytotoxicity receptor. NKp30 is expressed on both resting and activated NK cells of the CD56dim, CD16+ subset that account for more that 85% of NK cells found in peripheral blood and spleen. NKp30 is absent from the CD56bright, CD16- subset that constitutes the majority of NK cells in lymph node and tonsil, however, its expression is up-regulated in these cells upon IL-2 activation .NKp30 is a member of the immunoglobulin superfamily and one of three existing natural cytotoxicity-triggering receptors. NKp30 is a glycosylated protein and is thought to be selectively expressed in resting and activated natural killer cells. NKp30 is a stimulatory receptor on human NK cells implicated in tumor immunity, and is capable of promoting or terminating dendritic cell maturation. NCR3 may play a role in inflammatory and infectious diseases.
- Formulierung:
- Recombinant Human NKp30/NCR3/CD337 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu19-Thr138) of human NCR3/NKp300 (Accession #NP_001138938.1)
- Immunogen:
- Leu19-Thr138
- Molekulargewicht:
- 54-60 kda
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequenz:
- LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00179
