Recombinant Human Ephrin-A5/EFNA5 Protein
Produktgrößen
10 ug
£145,00
RP00176-10UG
20 ug
£193,00
RP00176-20UG
50 ug
£288,00
RP00176-50UG
100 ug
£431,00
RP00176-100UG
500 ug
£1240,00
RP00176-500UG
1000 ug
£1954,00
RP00176-1000UG
Über dieses Produkt
- SKU:
- RP00176
- Zusätzliche Namen:
- EFNA5,AF1,EFL5,EPLG7,GLC1M,LERK7,RAGS,ephrin-A5
- Weitere Details:
- Ephrin-A5 also known as EFNA5, is a member of the Ephrin family, prevents axon bundling in cocultures of cortical neurons with astrocytes, a model of late stage nervous system development and differentiation. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. EPH receptors typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin ligands and receptors have been named by the Eph Nomenclature Committee (1997). Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are similarly divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
- Formulierung:
- Recombinant Human Ephrin-A5/EFNA5 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln21-Asn203) of human Ephrin-A5/EFNA5 (Accession #NP_001953.1) fused
- Immunogen:
- Gln21-Asn203
- Molekulargewicht:
- 55-65 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00176

