Recombinant Human Flt3 ligand/Flt3L Protein
Produktgrößen
10 ug
£133,00
RP00175-10UG
20 ug
£181,00
RP00175-20UG
50 ug
£240,00
RP00175-50UG
100 ug
£353,00
RP00175-100UG
500 ug
£1002,00
RP00175-500UG
1000 ug
£1574,00
RP00175-1000UG
Über dieses Produkt
- SKU:
- RP00175
- Zusätzliche Namen:
- FL,FLT3L,FLT3LG,FLT3LG
- Weitere Details:
- FLT3LG, also known as flt3 ligand, is a small molecule that acts as a growth factor that increases the number of immune cells by activating the hematopoietic progenitors .FLT3LG is expressed as a noncovalently-linked dimer by T cells and bone marrow and thymic fibroblasts. Alternate splicing of human FLT3LG also generates membrane-associated isoforms that contain either a truncated cytoplasmic tail or an 85 aa substitution following the cytokine domain. Both transmembrane and soluble FLT3LG signal through the tyrosine kinase receptor Flt-3/Flk-2. FLT3LG induces the expansion of monocytes and immature dendritic cells as well as early B cell lineage differentiation. It synergizes with IL-3, GM-CSF, and SCF to promote the mobilization and myeloid differentiation of hematopoietic stem cells. It cooperates with IL-2, -6, -7, and -15 to induce NK cell development and with IL-3, -7, and -11 to induce terminal B cell maturation.
- Formulierung:
- Recombinant Human Flt3 ligand/Flt3L Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr27-Pro185) of human FLT3L/Flt3 ligand/FLT3LG (Accession #NP
- Immunogen:
- Thr27-Pro185
- Molekulargewicht:
- 20-37 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00175