Recombinant Human Junctional adhesion molecule C/JAM-3 (A149P) Protein
Produktgrößen
10 ug
£133,00
RP00170-10UG
20 ug
£181,00
RP00170-20UG
50 ug
£240,00
RP00170-50UG
100 ug
£353,00
RP00170-100UG
500 ug
£1002,00
RP00170-500UG
1000 ug
£1574,00
RP00170-1000UG
Über dieses Produkt
- SKU:
- RP00170
- Zusätzliche Namen:
- JAM3,JAM-2,JAM-3,JAM-C,JAMC
- Weitere Details:
- Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family. A mutation in an intron of this gene is associated with hemorrhagic destruction of the brain, subependymal calcification, and congenital cataracts. Alternative splicing results in multiple transcript variants.
- Formulierung:
- Recombinant Human Junctional adhesion molecule C/JAM-3 (A149P) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val32-Asn241 (Ala149Pro)) of human
- Immunogen:
- Val32-Asn241(A149P)
- Molekulargewicht:
- 60-70 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequenz:
- VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKPVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00170
