Recombinant Human TREM-1/CD354 Protein
Produktgrößen
10 ug
£133,00
RP00168-10UG
20 ug
£181,00
RP00168-20UG
50 ug
£240,00
RP00168-50UG
500 ug
£1002,00
RP00168-500UG
1000 ug
£1574,00
RP00168-1000UG
Über dieses Produkt
- SKU:
- RP00168
- Zusätzliche Namen:
- TREM1,CD354,TREM-1
- Weitere Details:
- TREM1 (triggering receptor expressed on myeloid cells) is a type I transmembrane protein with a single Ig-like domain, and is selectively expressed on blood neutrophils and a subset of monocytes. As a member of the growing family of receptors related to NK cell receptors, TREM1 activates downstream signaling events with the help of an adapter protein called DAP12. T TREM1 amplifies neutrophil and monocyte-mediated inflammatory responses triggered by bacterial and fungal infections by stimulating release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers.
- Formulierung:
- Recombinant Human TREM1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala21-Arg200) of human TREM1 (Accession #NP_061113.1) fused with an Fc, 6x
- Immunogen:
- Ala21-Arg200
- Molekulargewicht:
- 60-70 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00168