Recombinant Human SLAMF4/2B4/CD244 Protein
Produktgrößen
20 ug
£181,00
RP00167-20UG
50 ug
£240,00
RP00167-50UG
100 ug
£353,00
RP00167-100UG
500 ug
£1002,00
RP00167-500UG
1000 ug
£1574,00
RP00167-1000UG
Über dieses Produkt
- SKU:
- RP00167
- Zusätzliche Namen:
- CD244,2B4,NAIL,NKR2B4,Nmrk,SLAMF4
- Weitere Details:
- Cluster of differentiation 24, also known as signal transducer CD24 or heat stable antigen CD24 (HSA), is a mucin-type glycosylphosphatidylinositol-linked glycoprotein expressed on the surface of B-cells, differentiating neuroblasts and many tumors. It is involved in molecular adhesion and metastatic tumor spread and serve as a normal receptor for P-selectin. The CD24 / P-selectin pathway could be important in dissimenating of tumor cells by facilitating the interaction with platelet and endothelial cells. It has also been considered as a tumor marker. High rate of CD24 expressions have been found in epithelial ovarian cancer, breast cancer, non-small cell lung cancer, prostate cancer and pancreatic cancer.
- Formulierung:
- Recombinant Human SLAMF4/2B4/CD244 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Cys22-Arg221) of human 2B4/SLAMF/CD244 (Accession #NP_057466.1) fused
- Immunogen:
- Cys22-Arg221
- Molekulargewicht:
- 70-90 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00167
