Recombinant Human Cell surface A33 antigen/GPA33 Protein
Produktgrößen
10 ug
£133,00
RP00163-10UG
20 ug
£181,00
RP00163-20UG
50 ug
£240,00
RP00163-50UG
100 ug
£353,00
RP00163-100UG
500 ug
£1240,00
RP00163-500UG
1000 ug
£1954,00
RP00163-1000UG
Über dieses Produkt
- SKU:
- RP00163
- Zusätzliche Namen:
- A33,GPA33
- Weitere Details:
- Cell surface A33 antigen, also known as glycoprotein A33, is a single-pass type I membrane protein which is expressed in normal gastrointestinal epithelium and in 95% of colon cancers. GPA33 contains one Ig-like C2-type (immunoglobulin-like) domain and one Ig-like V-type (immunoglobulin-like) domain. The open reading frame encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. The predicted mature protein has a 213-amino acid extracellular region, a single transmembrane domain, and a 62-amino acid intracellular tail. Intracellular traffic and recycling to the cell surface appear to play a major role in GPA33 function and to have an influence on its surface density superseding translational regulation.
- Formulierung:
- Recombinant Human Cell surface A33 antigen/GPA33 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile22-Val235) of human GPA33/Glycoprotein-A33 (Ac
- Immunogen:
- Ile22-Val235
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00163