Recombinant Human IL-18BP Protein
Produktgrößen
100 ug
£240,00
RP00162-100UG
500 ug
£645,00
RP00162-500UG
1000 ug
£1002,00
RP00162-1000UG
Über dieses Produkt
- SKU:
- RP00162
- Zusätzliche Namen:
- IL18BP,IL18BPa
- Weitere Details:
- Interleukin-18-binding protein (IL-18BP) is a constitutively expressed and secreted protein. IL-18BP is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18), prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune responses. This protein is constitutively expressed and secreted in mononuclear cells. Elevated level of this protein is detected in the intestinal tissues of patients with Crohn's disease.
- Formulierung:
- Recombinant Human IL-18BP Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr31-Gly194) of human IL18BPa (Accession #NP_001034748.1) fused with an Fc, 6
- Immunogen:
- Thr31-Gly194
- Molekulargewicht:
- 60-75 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00162
