Recombinant Human AGER/RAGE Protein
Produktgrößen
10 ug
£133,00
RP00154-10UG
20 ug
£181,00
RP00154-20UG
50 ug
£240,00
RP00154-50UG
100 ug
£353,00
RP00154-100UG
500 ug
£1002,00
RP00154-500UG
1000 ug
£1574,00
RP00154-1000UG
Über dieses Produkt
- SKU:
- RP00154
- Zusätzliche Namen:
- AGER,RAGE,SCARJ1
- Weitere Details:
- Receptor for Advanced Glycosylation End Products (RAGE, or AGER) is a member of the immunoglobulin super-family transmembrane proteins, as a signal transduction receptor which binds advanced glycation endproducts, certain members of the S100/calgranulin family of proteins, high mobility group box 1 (HMGB1), advanced oxidation protein products, and amyloid (beta-sheet fibrils). It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, development, and inflammation, and certain diseases, such as atherosclerosis, arthritis, Alzheimer's disease, atherosclerosis and aging associated diseases.
- Formulierung:
- Recombinant Human AGER/RAGE Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln24-Ala344) of human AGER/RAGE (Accession #NP_001127.1) fused with an Fc,
- Immunogen:
- Gln24-Ala344
- Molekulargewicht:
- 80-100 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 90% as determined by SDS-PAGE;≥ 90%
- Sequenz:
- QNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00154