Recombinant Human uPA/PLAU Protein
Produktgrößen
10 ug
£145,00
RP00146LQ-10UG
20 ug
£193,00
RP00146LQ-20UG
50 ug
£288,00
RP00146LQ-50UG
100 ug
£431,00
RP00146LQ-100UG
500 ug
£1503,00
RP00146LQ-500UG
1000 ug
£2360,00
RP00146LQ-1000UG
Über dieses Produkt
- SKU:
- RP00146LQ
- Zusätzliche Namen:
- PLAU,ATF,BDPLT5,QPD,UPA,URK,u-PA,urokinase
- Weitere Details:
- Plasminogen activator, urokinase, also known as PLAU and uPA, is a serine protease which converts plasminogen to plasmin, a broad-spectrum protease active on extracellular matrix (ECM) components. It is involved in complement activation, cell migration, wound healing, and generation of localized extracellular proteolysis during tissue remodelling, pro-hormone conversion, carcinogenesis and neoplasia. uPA and its receptor (uPAR) have been implicated in a broad spectrum of pathophysiological processes, including fibrinolysis, proteolysis, inflammation, atherogenesis and plaque destabilization, all of which are involved in the pathogenesis of MI (myocardial infarction). The role of uPA is not only does it as a kind of enzyme, but also is breast cancer, stomach cancer, colon cancer, bladder cancer, ovarian cancer, brain, and endometrial cancer markers for a strong invasion and metastasis.Because of the causal involvment of uPA in cancer invasion and metastasis, the blockade of uPA interactions and activity with specific inhibitors is of interest for novel strategies in cancer therapy.
- Formulierung:
- Recombinant Human uPA/PLAU Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Leu431) of human Urokinase/PLAU (Accession #NP_002649.1) fused wit
- Immunogen:
- Met1-Leu431
- Molekulargewicht:
- 55 kDa
- Reinheit:
- ≥95%
- Sequenz:
- MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
- Versandbedingungen:
- Dry Ice
- Lagerbedingungen:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP00146LQ
