Recombinant Human Ephrin-A4/EFNA4 Protein
Produktgrößen
10 ug
£107,00
RP00143-10UG
20 ug
£133,00
RP00143-20UG
50 ug
£163,00
RP00143-50UG
100 ug
£240,00
RP00143-100UG
500 ug
£645,00
RP00143-500UG
1000 ug
£1002,00
RP00143-1000UG
Über dieses Produkt
- SKU:
- RP00143
- Zusätzliche Namen:
- EFL4,EPLG4,LERK4,EFNA4
- Weitere Details:
- EPH-related receptor tyrosine kinase ligand 4 (Ephrin-A4) also known as EFNA4, is a member of the Ephrin family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest known subfamily of receptor protein-tyrosine kinases (RTKs). Eph/ephrin interactions are implicated in axon guidance, neural crest cell migration, establishment of segmental boundaries, and formation of angiogenic capillary plexi. Ephrin subclasses are further distinguished by their mode of attachment to the plasma membrane: ephrin-A ligands bind EphA receptors and are anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage, whereas ephrin-B ligands bind EphB receptors and are anchored via a transmembrane domain. Ephrin-A4/EFNA4 functions as a cell surface GPI-bound ligand for Eph receptor, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development.
- Formulierung:
- Recombinant Human Ephrin-A4/EFNA4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu26-Gly171) of human Ephrin-A4/EFNA4 (Accession # NP_005218.1)
- Immunogen:
- Leu26-Gly171
- Molekulargewicht:
- 55-60 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- 85%
- Sequenz:
- LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00143

