Recombinant Human OX-2/CD200 Protein
Produktgrößen
10 ug
£127,00
RP00127-10UG
20 ug
£175,00
RP00127-20UG
50 ug
£240,00
RP00127-50UG
100 ug
£336,00
RP00127-100UG
500 ug
£1002,00
RP00127-500UG
1000 ug
£1574,00
RP00127-1000UG
Über dieses Produkt
- SKU:
- RP00127
- Zusätzliche Namen:
- CD200,MOX1,MOX2,MRC,OX-2
- Weitere Details:
- The protein is a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Formulierung:
- Recombinant Human OX-2/CD200 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln31-Gly232) of human CD200/OX-2 (Accession #NP_005935.4) fused with a 6xH
- Immunogen:
- Gln31-Gly232
- Molekulargewicht:
- 40-50 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00127
