Recombinant Human FCAR/CD89 Protein
Produktgrößen
10 ug
£133,00
RP00113-10UG
20 ug
£181,00
RP00113-20UG
50 ug
£240,00
RP00113-50UG
500 ug
£1002,00
RP00113-500UG
1000 ug
£1574,00
RP00113-1000UG
Über dieses Produkt
- SKU:
- RP00113
- Zusätzliche Namen:
- FCAR,CD89,CTB-61M7.2,FcalphaRI
- Weitere Details:
- This protein is a member of the immunoglobulin gene superfamily and receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Formulierung:
- Recombinant Human FCAR/CD89 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln22-Asn227) of human CD89/FCAR (Accession #NP_001991.1) fused with an Fc,
- Immunogen:
- Gln22-Asn227
- Molekulargewicht:
- 65-75 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00113