Recombinant Human Basigin/EMMPRIN/CD147 Protein
Produktgrößen
20 ug
£181,00
RP00104-20UG
50 ug
£240,00
RP00104-50UG
100 ug
£353,00
RP00104-100UG
500 ug
£1002,00
RP00104-500UG
1000 ug
£1574,00
RP00104-1000UG
Über dieses Produkt
- SKU:
- RP00104
- Zusätzliche Namen:
- 5F7, CD147, EMMPRIN, OK, TCSF,BSG, 5F7, basigin,CD147,EMMPRIN,OK,TCSF,basigin
- Weitere Details:
- This protein is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.
- Formulierung:
- Recombinant Human Basigin/EMMPRIN/CD147 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr25-His205) of human CD147/EMMPRIN/Basigin (Accession #NP_0017
- Immunogen:
- Thr25-His205
- Molekulargewicht:
- 65-75 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- TVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00104
