Recombinant Human ALK-4/ACVR1B Protein
Produktgrößen
50 ug
£163,00
RP00074-50UG
100 ug
£240,00
RP00074-100UG
500 ug
£645,00
RP00074-500UG
1000 ug
£1002,00
RP00074-1000UG
Über dieses Produkt
- SKU:
- RP00074
- Zusätzliche Namen:
- ACTRIB, ACVRLK4, ALK4, SKR2,ACVR1B,ACVRLK4,ALK4,SKR2
- Weitere Details:
- ALK-4 (Activin Receptor-Like Kinase 4) or ACVR1B (Activin A Receptor, type 1B), belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, and TGFB receptor subfamily. ALK-4/ACVR1B acts as a transducer of activin or activin like ligands signals. Activin binds to either ACVR2A or ACVR2B and then forms a complex with ACVR1B. The known type II activin receptors include ActRII and ActRIIB, while the main type I activin receptor in mammalian cells is ALK-4 (ActRIB). In the presence of activin, type II and type I receptors form complexes whereby the type II receptors activate ALK-4 through phosphorylation. The activated ALK-4, in turn, transduces signals downstream by phosphorylation of its effectors, such as Smads, to regulate gene expression and affect cellular phenotype. ALK-4/ACVR1B is an important regulator of vertebrate development, with roles in mesoderm induction, primitive streak formation, gastrulation, dorsoanterior patterning, and left-right axis determination.
- Formulierung:
- Recombinant Human ALK-4/ACVR1B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Glu 126) of human ACVR1B (Accession #NP_004293.1) fused with
- Immunogen:
- Met1-Glu126
- Molekulargewicht:
- 45-50 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP00074
