Recombinant Human Ep-CAM/TROP-1/CD326 Protein
Produktgrößen
10 ug
£133,00
RP00073-10UG
20 ug
£181,00
RP00073-20UG
50 ug
£240,00
RP00073-50UG
100 ug
£353,00
RP00073-100UG
500 ug
£1002,00
RP00073-500UG
1000 ug
£1574,00
RP00073-1000UG
Über dieses Produkt
- SKU:
- RP00073
- Zusätzliche Namen:
- DIAR5, EGP-2, EGP314, EGP40, ESA, HNPCC8, KS1/4, KSA, M4S1, MIC18, MK-1, TACSTD1, TROP1,EPCAM, DIAR5, epithelial cell adhesion molecule,EGP-2,EGP314,EGP40,ESA,HNPCC8,KS1/4,KSA,M4S1,MIC18,MK-1,TACSTD1,TROP1
- Weitere Details:
- This protein is a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas.
- Formulierung:
- Recombinant Human Ep-CAM/TROP-1/CD326 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Lys265) of human EpCAM/TROP-1 (Accession #NP_002345.2)
- Immunogen:
- Gln24-Lys265
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00073