Recombinant Human FGF-12 Protein
Produktgrößen
10 ug
£133,00
RP00064-10UG
20 ug
£181,00
RP00064-20UG
500 ug
£1002,00
RP00064-500UG
1000 ug
£1574,00
RP00064-1000UG
Über dieses Produkt
- SKU:
- RP00064
- Zusätzliche Namen:
- FGF12,EIEE47,FGF12B,FHF1
- Weitere Details:
- The protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted.
- Formulierung:
- Recombinant Human FGF-12 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Thr181) of human FGF-12 (Accession #NP_004104.3) fused with a 6xHis tag a
- Immunogen:
- Met1-Thr181
- Molekulargewicht:
- 18-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00064
