Recombinant Human TNFSF9/4-1BB Ligand Protein
Produktgrößen
10 ug
£133,00
RP00060-10UG
20 ug
£181,00
RP00060-20UG
50 ug
£240,00
RP00060-50UG
100 ug
£353,00
RP00060-100UG
500 ug
£1002,00
RP00060-500UG
1000 ug
£1574,00
RP00060-1000UG
Über dieses Produkt
- SKU:
- RP00060
- Zusätzliche Namen:
- 4-1BB-L, CD137L, TNLG5A,TNFSF9,CD137L,TNLG5A
- Weitere Details:
- The protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.
- Formulierung:
- Recombinant Human TNFSF9/4-1BB Ligand Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg71-Glu254) of human 4-1BB Ligand/TNFSF9 (Accession #NP_003802.
- Immunogen:
- Arg71-Glu254
- Molekulargewicht:
- 18-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00060
