Recombinant Human Oncostatin-M/OSM Protein
Produktgrößen
10 ug
£145,00
RP00054-10UG
20 ug
£193,00
RP00054-20UG
50 ug
£264,00
RP00054-50UG
100 ug
£395,00
RP00054-100UG
500 ug
£1157,00
RP00054-500UG
1000 ug
£1812,00
RP00054-1000UG
Über dieses Produkt
- SKU:
- RP00054
- Zusätzliche Namen:
- OSM, oncostatin-M
- Weitere Details:
- This protein is a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family. The preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells.
- Formulierung:
- Recombinant Human Oncostatin-M/OSM Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala26-Arg221) of human Oncostatin-M/OSM (Accession #NP_065391.1).
- Immunogen:
- Ala26-Arg221
- Molekulargewicht:
- 20-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00054



