Recombinant Human TNFSF15/TL1 Protein
Produktgrößen
10 ug
£145,00
RP00053-10UG
20 ug
£193,00
RP00053-20UG
50 ug
£288,00
RP00053-50UG
100 ug
£431,00
RP00053-100UG
500 ug
£1240,00
RP00053-500UG
1000 ug
£1954,00
RP00053-1000UG
Über dieses Produkt
- SKU:
- RP00053
- Zusätzliche Namen:
- TNFSF15,TL1,TL1A,TNLG1B,VEGI,VEGI192A
- Weitere Details:
- The protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor.
- Formulierung:
- Recombinant Human TNFSF15/TL1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Leu72-Leu251) of human TL1A/TNFSF15 (Accession #NP_005109.2) fused with a
- Immunogen:
- Leu72-Leu251
- Molekulargewicht:
- 21 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00053





