Recombinant Human IL-11 Protein
Produktgrößen
10 ug
£145,00
RP00050-10UG
20 ug
£193,00
RP00050-20UG
50 ug
£288,00
RP00050-50UG
100 ug
£431,00
RP00050-100UG
500 ug
£1240,00
RP00050-500UG
1000 ug
£1954,00
RP00050-1000UG
Über dieses Produkt
- SKU:
- RP00050
- Zusätzliche Namen:
- IL11,AGIF,IL-11
- Weitere Details:
- The protein is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells.
- Formulierung:
- Recombinant Human IL-11 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro22-Leu199) of human IL-11 (Accession #NP_000632.1) fused with an initial Met
- Immunogen:
- Pro22-Leu199
- Molekulargewicht:
- 21 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00050
