Recombinant Human Leptin/LEP Protein
Produktgrößen
50 ug
£127,00
RP00028-50UG
500 ug
£354,00
RP00028-500UG
1000 ug
£509,00
RP00028-1000UG
Über dieses Produkt
- SKU:
- RP00028
- Zusätzliche Namen:
- LEP,LEPD,OB,OBS,leptin
- Weitere Details:
- Leptin is one of the most important hormones secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this protein and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This protein has also been linked to type 2 diabetes mellitus development.
- Formulierung:
- Recombinant Human Leptin/LEP Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val22-Cys167) of human Leptin (Accession #NP_000221.1).
- Immunogen:
- Val22-Cys167
- Molekulargewicht:
- 14 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00028
