Recombinant Human IL-33 Protein
Produktgrößen
10 ug
£163,00
RP00019-10UG
50 ug
£336,00
RP00019-50UG
100 ug
£508,00
RP00019-100UG
500 ug
£1716,00
RP00019-500UG
1000 ug
£2716,00
RP00019-1000UG
Über dieses Produkt
- SKU:
- RP00019
- Zusätzliche Namen:
- IL33,C9orf26,DVS27,IL1F11,NF-HEV,NFEHEV
- Weitere Details:
- Interleukin 33 (IL-33), also known as DVS27 or NF-HEV (Nuclear Factor from High Endothelial enules), is a proinflammatory protein and a chromatin-associated cytokine of the IL-1 family with high sequence and structural similarity to IL-1 and IL-18. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells.
- Formulierung:
- Recombinant Human IL-33 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser112-Thr270) of human IL-33 (Accession #NP_001300973.1).
- Immunogen:
- Ser112-Thr270
- Molekulargewicht:
- 19 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00019
