Recombinant Human PIN1 Protein
Produktgrößen
10 ug
£133,00
RP00015-10UG
20 ug
£181,00
RP00015-20UG
100 ug
£353,00
RP00015-100UG
500 ug
£1002,00
RP00015-500UG
1000 ug
£1574,00
RP00015-1000UG
Über dieses Produkt
- SKU:
- RP00015
- Zusätzliche Namen:
- PIN1,DOD,UBL5
- Weitere Details:
- Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This protein is a nucleus protein which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers.
- Formulierung:
- Recombinant Human PIN1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu163) of human PIN1 (Accession #NP_006212.1).
- Immunogen:
- Met1-Glu163
- Molekulargewicht:
- 18 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP00015
