Recombinant Human UBE2D3 Protein
Produktgrößen
10 ug
£107,00
RP00012-10UG
20 ug
£133,00
RP00012-20UG
50 ug
£163,00
RP00012-50UG
100 ug
£240,00
RP00012-100UG
500 ug
£645,00
RP00012-500UG
1000 ug
£1002,00
RP00012-1000UG
Über dieses Produkt
- SKU:
- RP00012
- Zusätzliche Namen:
- UBE2D3,E2(17)KB3,UBC4/5,UBCH5C
- Weitere Details:
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.
- Formulierung:
- Recombinant Human UBE2D3 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Met147) of human UBE2D3 (Accession #NP_003331.1) fused with a 6xHis tag a
- Immunogen:
- Met1-Met147
- Molekulargewicht:
- 14-18 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP00012
