Recombinant Human S100-A12 Protein
Produktgrößen
50 ug
£240,00
RP00009-50UG
100 ug
£353,00
RP00009-100UG
500 ug
£1002,00
RP00009-500UG
1000 ug
£1574,00
RP00009-1000UG
Über dieses Produkt
- SKU:
- RP00009
- Zusätzliche Namen:
- S100A12,CAAF1,CAGC,CGRP,ENRAGE,MRP-6,MRP6,p6
- Weitere Details:
- The protein is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 proteins include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity.
- Formulierung:
- Recombinant Human S100-A12 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu92) of human S100A12 (Accession #NP_005612.1) fused with a 6xHis tag
- Immunogen:
- Met1-Glu92
- Molekulargewicht:
- Approximately 14 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00009
