Recombinant Human IL-1 beta Protein
Produktgrößen
10 ug
£145,00
RP00002-10UG
20 ug
£193,00
RP00002-20UG
50 ug
£288,00
RP00002-50UG
100 ug
£431,00
RP00002-100UG
500 ug
£1240,00
RP00002-500UG
1000 ug
£1954,00
RP00002-1000UG
Über dieses Produkt
- SKU:
- RP00002
- Zusätzliche Namen:
- IL-1,IL1-BETA,IL1F2,IL1 beta,IL1B
- Weitere Details:
- Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family.This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity.
- Formulierung:
- Recombinant Human IL-1 beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala117-Ser269) of human IL-1 beta (Accession #NP_000567.1) fused with an in
- Immunogen:
- Ala117-Ser269
- Molekulargewicht:
- 18 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP00002
