BAF60a Rabbit polyclonal antibody
Produktgrößen
20 ul
£151,00
A9950-20UL
100 ul
£336,00
A9950-100UL
500 ul
£1258,00
A9950-500UL
1000 ul
£2228,00
A9950-1000UL
Über dieses Produkt
- SKU:
- A9950
- Zusätzliche Namen:
- Baf60a|D15Kz1
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable several functions, including chromatin binding activity; molecular adaptor activity; and transcription coregulator activity. Predicted to be involved in epigenetic maintenance of chromatin in transcription-competent conformation; nucleosome disassembly; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within chromatin organization and nervous system development. Part of SWI/SNF complex; nBAF complex; and npBAF complex. Is expressed in several structures, including central nervous system; dorsal root ganglion; early conceptus; genitourinary system; and retina layer. Human ortholog(s) of this gene implicated in Coffin-Siris syndrome. Orthologous to human SMARCD1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 58kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- MAARAGFQSVAPSGGAGASGGAGVAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A9950