MT-ND3 Rabbit polyclonal antibody
Produktgrößen
20 ul
£151,00
A9940-20UL
100 ul
£336,00
A9940-100UL
500 ul
£1258,00
A9940-500UL
1000 ul
£2228,00
A9940-1000UL
Über dieses Produkt
- SKU:
- A9940
- Zusätzliche Namen:
- MT-ND3|ND3
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable NADH dehydrogenase (ubiquinone) activity. Predicted to be involved in cellular response to glucocorticoid stimulus; mitochondrial electron transport, NADH to ubiquinone; and response to oxidative stress. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; genitourinary system; hemolymphoid system gland; and liver and biliary system. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; Leigh disease; and Parkinson's disease. Orthologous to human MT-ND3 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 3).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 13kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- MNLYTVIFINILLSLTLILVAFWLPQMNLYSEKANPYECGFDPTSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQTIKTSTMMIMAFILVTILSL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A9940