Sterol carrier protein 2 Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A9430-5UL
20 ul
£163,00
A9430-20UL
100 ul
£342,00
A9430-100UL
500 ul
£1532,00
A9430-500UL
1000 ul
£2704,00
A9430-1000UL
Über dieses Produkt
- SKU:
- A9430
- Zusätzliche Namen:
- NLTP|NSL-TP|SCOX|SCP-2|SCP-CHI|SCP-X|SCPX|Sterol carrier protein 2
- Anwendung:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 59kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A9430