Cytokeratin 16 (KRT16) Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A8690-5UL
20 ul
£163,00
A8690-20UL
100 ul
£342,00
A8690-100UL
500 ul
£1532,00
A8690-500UL
1000 ul
£2704,00
A8690-1000UL
Über dieses Produkt
- SKU:
- A8690
- Zusätzliche Namen:
- CK16|Cytokeratin 16 (KRT16)|FNEPPK|K16|K1CP|KRT16A|NEPPK|PC1
- Anwendung:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 51kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGGACGLGGGYGGGFSSSSSFGSGFGGGYGGGLGAGFGGGLGA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A8690