BAIAP2L1 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A8238-20UL
100 ul
£336,00
A8238-100UL
500 ul
£1258,00
A8238-500UL
1000 ul
£2228,00
A8238-1000UL
Über dieses Produkt
- SKU:
- A8238
- Zusätzliche Namen:
- BAIAP2L1|IRTKS
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- This gene encodes a member of the IMD (IRSp53/MIM homology domain) family. Members of this family can be subdivided in two groups, the IRSp53-like and MIM-like, based on the presence or absence of the SH3 (Src homology 3) domain. The protein encoded by this gene contains a conserved IMD, also known as F-actin bundling domain, at the N-terminus, and a canonical SH3 domain near the C-terminus, so it belongs to the IRSp53-like group. This protein is the substrate for insulin receptor tyrosine kinase and binds to the small GTPase Rac. It is involved in signal transduction pathways that link deformation of the plasma membrane and remodeling of the actin cytoskeleton. It also promotes actin assembly and membrane protrusions when overexpressed in mammalian cells, and is essential to the formation of a potent actin assembly complex during EHEC (Enterohemorrhagic Escherichia coli) pedestal formation.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 57kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- DKHCGFANHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIMNMIEEIKTPASTPVSGTPQASPMIERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A8238