COX1 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A7531-20UL
100 ul
£336,00
A7531-100UL
500 ul
£1258,00
A7531-500UL
1000 ul
£2228,00
A7531-1000UL
Über dieses Produkt
- SKU:
- A7531
- Zusätzliche Namen:
- COX1|CoxI
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables cytochrome-c oxidase activity. Predicted to be involved in electron transport coupled proton transport; mitochondrial electron transport, cytochrome c to oxygen; and response to oxidative stress. Located in mitochondrial inner membrane. Part of mitochondrial respiratory chain complex IV. Is expressed in several structures, including brown fat; heart; liver; metanephros; and skeletal muscle. Orthologous to human MT-CO1 (mitochondrially encoded cytochrome c oxidase I).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 37 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- AIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSMGSFISLTAVLIMIFMIWEAFASKREVMSVSYASTNLEWLHGCPPPYHTFEEPTYVKVK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A7531