Bcl9 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A6795-20UL
100 ul
£336,00
A6795-100UL
500 ul
£1258,00
A6795-500UL
1000 ul
£2228,00
A6795-1000UL
Über dieses Produkt
- SKU:
- A6795
- Zusätzliche Namen:
- 2610202E01Rik|8030475K17Rik|A330041G23Rik|Bcl9|Gm130
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables beta-catenin binding activity. Acts upstream of or within several processes, including myotube differentiation involved in skeletal muscle regeneration; skeletal muscle cell differentiation; and somatic stem cell population maintenance. Located in cis-Golgi network and nucleus. Is expressed in several structures, including brain; eye; head surface ectoderm; metanephros; and thymus primordium. Orthologous to human BCL9 (BCL9 transcription coactivator).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 160kDa/170kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- DQAPRMGLALPGMGGPGPVGTPDIPLGTSPSMPGHNPMRPPAFLQQGMMGPHHRMMSPAQSTVPGPATLMTNPAAAVGMIPGKDRGPAGLYTHPGPVGSP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A6795