THRA Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A5592-20UL
100 ul
£336,00
A5592-100UL
500 ul
£1258,00
A5592-500UL
1000 ul
£2228,00
A5592-1000UL
Über dieses Produkt
- SKU:
- A5592
- Zusätzliche Namen:
- AR7|c-erbA|c-ERBA-1|CHNG6|EAR7|ERB-T-1|ERBA|ERBA1|NR1A1|THRA|THRA1|THRA2|THRalpha|THRalpha1|THRalpha2|TRalpha|TRalpha1|TRalpha2
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 55kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- IEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A5592