CD20 Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A4893-5UL
20 ul
£164,00
A4893-20UL
100 ul
£342,00
A4893-100UL
500 ul
£1532,00
A4893-500UL
1000 ul
£2704,00
A4893-1000UL
Über dieses Produkt
- SKU:
- A4893
- Zusätzliche Namen:
- B1|Bp35|CD20|CVID5|FMC7|LEU-16|S7
- Anwendung:
- Detection/Quantitation, ELISA, Flow Cytometry, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 25-35 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A4893