COTL1 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A4550-20UL
100 ul
£336,00
A4550-100UL
500 ul
£1258,00
A4550-500UL
1000 ul
£2228,00
A4550-1000UL
Über dieses Produkt
- SKU:
- A4550
- Zusätzliche Namen:
- CLP|COTL1
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 14kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A4550