Calbindin Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A4284-5UL
20 ul
£164,00
A4284-20UL
100 ul
£342,00
A4284-100UL
500 ul
£1532,00
A4284-500UL
1000 ul
£2704,00
A4284-1000UL
Über dieses Produkt
- SKU:
- A4284
- Zusätzliche Namen:
- CALB|Calbindin|D-28K
- Anwendung:
- ELISA, Immunofluorescence, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- The protein encoded by this gene is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. Originally described as a 27 kDa protein, it is now known to be a 28 kDa protein. It contains four active calcium-binding domains, and has two modified domains that are thought to have lost their calcium binding capability. This protein is thought to buffer entry of calcium upon stimulation of glutamate receptors. Depletion of this protein was noted in patients with Huntington disease.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 30 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSC
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A4284